<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-8034 8034-30619 U.K. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82T   L10I, L19I, K20R, E35D, M36I, N37S, D60E, I62V, L63P, A71V, T74S, I93L G94D
>8034-30619| codons 1-99
PQITLWQRPIVTIKIGGQIREALLDTGADDTVLEDISLPGRWKPKMIGGIGGFVKVRQYE
QVPIEICGHKVIGSVLVGPTPTNIIGRNLLTQLDCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219E K103N   K20KR, V60I, D121Y, K122E, D123E, I135T, I178M, E203K, V245T, I257L, I293V, M357T, A376S, T377L, K390R, A400S  
>8034-30619| codons 1-400
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
YEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIKELRQHLLRWGFTTPDEKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDLQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEAVQKISLESIVIWGKTPKFRLPIQKETWES

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006