<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-8011 8011-30506 U.K. 2003 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74V, M184V, T215Y K219Q, N348I Y181C K101N, V108I V8VG, K32Q, V35T, T39A, E44D, V60I, V118I, D121H, K122E, I135R, S162DN, K173V, Q174N, D177E, V179VA, T200A, I202V, Q207D, H221Y, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, P321S, D324E, I329V, Q334L, G335D, P345Q, F346Y, R356K, M357R, R358G, G359S, T386V, K390R, Q394R, E399D P9PL, A371GV
>8011-30506| codons 1-399
PISPIETGLVKLKPGMDGPKVKQWPLTEEKIQALTEICAELEKDGKISKIGPENPYNTPI
FAIKKKNSTRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLNKKKSVTILDVGDAYFSIPL
HEDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRVNNPEIAI
CQYVDDLYVGSDLEIGQHRAKVEELRDHLLRWGFYTPDQKYQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDSSKELIAEVQKQGLDQWTYQIYQEQYKILKTGKYAKRGSA
HTNDVKQLTEVVQKIATESIVIWGKVPKFRLPIRKETWD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V L33F, F53L I13V, K14R, K20T, M36I, N37D, R41K, L63LP, C67E, H69K, T74A, V82I, L89M E35R
>8011-30506| codons 1-99
PQITLWQRPLVTVRIGGQLTEALLDTGADDTVFERIDLPGKWKPKIIGGVGGLIKVRQYD
QIPIEIEGKKAIGAVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006