<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-7228 7228-30930 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, T215F K219Q K103N, Y181C   V35I, T39TA, D123E, I135T, T139K, K166R, D177E, G196E, T200A, I202V, Q207E, R211RK, E248ED, A272P, P321AS, D324E, Q334L, M357A, T386I, K390R  
>7228-30930| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAEMEKEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNEKPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIVI
CQYMDDLYVGSDLEIEQHRAKVEELREHLLKWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDSSKELIAEIQKQGLGQWTYQIYQEPFKNLKTGKYARARGA
HTNDVKQLTEAVQKIATESIVIWGKIPKFRLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   T12E, L63P, A71V, V77I, I93L  
>7228-30930| codons 1-99
PQITLWQRPLVEIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006