<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-7211 7211-30930 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, L74I, M184V, T215F V75A, K219Q, N348I K103N, Y181C V179F E6D, V35I, K102KR, I135T, I202IV, D218E, L228H, D250E, A272P, I293V, P294ST, E297K, I329L, G333DE, Y342F, R356K, M357R, A360V, T386TI, K390R, A400AT  
>7211-30930| codons 2-400
ISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPVF
AIKKKNSDRWRKIADFRELNKRTQDFWEVQLGIPHPAGLKRNKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIFIC
QYVDDLYVGSDLEIGQHRTKVEELRQHLLRWGFFTPEQKHQKEPPFHWMGYELHPDKWTV
QPIVLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVTLTKEAEL
ELAENREILKEPVHGVYYDPSKDLIAELQKQEQGQWTYQIFQEPFKILKTGKYAKRRGVH
TNDVKQLTEAVQKIATESIVIWGKIPKFRLPIQKETWET

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L24I, L33I, K43T, G73T L10I, Q18H, K20R, E35D, M36I, L63P, I64V, A71V, I72M  
>7211-30930| codons 1-99
PQITLWQRPIVTIKIGGHLREALIDTGADDTVIEDINLPGRWTPKIIGGIGGFVKVRQYD
QIPVEICGHKVMTTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006