<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9051 9051-30930 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T215Y   K103N   K43KE, V90I, I178M, V189VI, T200A, Q207E, H208HY, R211K, V245E  
>9051-30930| codons 38-247
CTEMEEEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEIQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDMVIYQYMDDLYIGSDLEIGQHRAKIEELREYLLKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M   L10I, I13V, K20T, L63P, I64V, A71V, I72V, V77T, I93L  
>9051-30930| codons 4-99
TLWQRPIVTVKIGGQLTEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYDQIP
VEICGHKVVGTVLTGPTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006