<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9048 9048-30929 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, I84V L24I, G73GACS L10I, I15V, K20R, M36I, R41K, L63P, I66V, A71V, I93L  
>9048-30929| codons 4-99
TLWQRPIVTIKVGGQLREALIDTGADDTVLEEINLPGKWKPKIIGGIGGFVKVRQYDQIP
IEVCGHKVISTVLVGPTPTNVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y K219N K103N, Y181C, G190A   E44D, K101Q, K102KN, V118I, K122E, I135T, A158S, S162C, E194EQ, Q197K, T200A, I202V, R211K, D218E  
>9048-30929| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLQNNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
SIFQCSMTKILEPFRKQNPDIVICQYMDDLYVASDLQIGKHRAKVEELRQHLWKWGFYTP
ENKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006