<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9049 9049-30929 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219N Y181C, G190A V108I, F227L T39A, E44D, K101Q, L109LI, V118I, K122E, I135T, I195M, E203K, H208Y, H221Y  
>9049-30929| codons 38-247
CAELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTIIDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYMDDLYVASDLEMGQHRTKIKELRQYLWRWGFYTP
DNKYQKEPPLLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, I84V   L10I, T12K, I13IV, L19I, E35D, N37D, I64V, I66F, A71V, P79A, T91A, Q92K, I93V  
>9049-30929| codons 4-99
TLWQRPIVKVKIGGQIKEALLDTGADDTVLEDMDLPGRWKPKIIGGIGGFVKVRQYDQIL
VEFCGHKVIGTVVVGATPVNVIGRNLLAKVGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006