<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9044 9044-30925 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y V75M, K219N G190E   K43N, E44AD, K101KQR, V118I, K122E, I135T, E138A, K166R, V179G, I202V, R211K L187LS
>9044-30925| codons 38-247
CTELENDGKISKIGPENPYNTPVFAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLRKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPDIGIYQYMDDSYVESDLEIGQHRTKVEELRQHLWKWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54IV, V82F, I84V L33F, T74P L10I, I15V, G16E, Q18R, L19P, K20L, N37S, I62IV, V77VI, I85V, L89M  
>9044-30925| codons 4-99
TLWQRPIVTIKVEGRPLEALLDTGADDTVFEEMSLPGRWKPKIIGGIGGFVKVRQYDQVL
IEICGHKAIGPVLIGPTPFNVVGRNMLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006