<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9042 9042-30924 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V, T215Y K219E Y188L, M230ML   T39A, K49R, S68G, K102Q, L109I, K122E, I135T, S162C, I178IM, F227Y, D237DN, V245M  
>9042-30924| codons 38-247
CAEMEKEGKISRIGPENPYNTPVFAIKKKDGTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKQKKSVTVIDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDMVIYQYVDDLLVGSDLEIGQHRTKIEELRQHLLRWGFYTP
DEKHQKEPPYLWLGYELHPNKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, V82A, L90M L33F, G73C L10I, T12N, I13V, G16E, K20V, E34EQ, K55R, R57K, Q61D, I72R, V77I  
>9042-30924| codons 4-99
TLWQRPIVNVKIEGQLVEALLDTGADDTVFQEMNLPGRWKPKMIGGIGGFLRVKQYDDIL
IEICGHKARCTVLIGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006