<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
503-223 503-223W20 U.S. 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NFV 20

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S   L10I, T12X, I13V, E35D, M36V, N37D, P39X, I62V, L63P, A71V, V77I, V82I  
>503-223W20| codons 1-99
PQITLWQRPIVXVKIGGQLKEALLDTGADDTVLEDVDLXGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVIGTVLIGPTPINIIGRSLLTQIGCTLNF

References
Author Title Citation
Patick, AK Genotypic and phenotypic characterization of human immunodeficiency virus type 1 variants isolated from patients treated with the protease inhibitor nelfinavir. AAC, 1998
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005