<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9140 9140-30930 Brazil 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10LV, T12N, I15V, K20R, E35D, M36I, R41K, K55KR, R57K, Q61N, L63A, E65D, K70Q, I93IL  
>9140-30930| codons 4-99
TLWQRPVVNIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIRVKQYDNIA
IDICGHQAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103KN   V90VI, D123E, I135L, S162CW, K166KQ, E169D, K173A, Q174K, D177N, T200A, R211K, V245Q  
>9140-30930| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQWSMTQILDPFRAKNPNIVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006