<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9139 9139-30925 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48A, I54V, V82S   L10V, G16A, K20R, E35D, M36I, I62V, L63C, A71V, T74S, I93L  
>9139-30925| codons 4-99
TLWQRPVVTIKIAGQLREALLDTGADDTVLEDINLPGRWKPKLIAGIGGFVKVRQYDQVC
IEICGHKVIGSVLVGPTPSNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, L210W, T215Y V75T, K219E K103N A98G E44D, I94L, V118I, I135L, S162SN, T200A, E203D, H208HY, R211K, D218E  
>9139-30925| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSTRWRKITDFRELNKRTQDFWEVQLGLPHP
GGLKKNKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQNSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIDELRQYLWKWGFYTP
EEKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006