<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9130 9130-30918 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, V75VM, T215Y   K103N, G190A   R83K, V90I, V118VI, I178M, T200A, R211K, L228H  
>9130-30918| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLMDFRELNKKTQDFWEIQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDMVIYQYMDDLYVASDLEIGQHRAKIEELRQHLLKWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30DN, M46I, V82A N88D I15V, K20M, E35DG, M36I, N37E, R41K, K43KR, K55R, R57K, Q61N, L63P, I93L  
>9130-30918| codons 4-99
TLWQRPLVTIKVGGQLMEALLDTGADNTVLEGIELPGKWRPKIIGGIGGFIRVKQYDNIP
IEICGHKAIGTVLVGPTPANIIGRDLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006