<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9125 9125-30918 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54A, V82C, I84V L24I, L33F, K43T L10I, L19I, K20R, E34EQ, E35D, M36I, N37S, I62V, L63P, I64V, A71V, Q92K  
>9125-30918| codons 4-99
TLWQRPIVTIKIGGQIREALIDTGADDTVFQDISLPGRWTPKLIGGIGGFAKVRQYDQVP
VEICGHKVIGTVLVGPTPCNVIGRNLLTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y K219N L100I, K103N, Y181C A98G E44D, V60I, V118I, K122E, I135T, I202V, E203A, Q207N, H208Y, R211K, K223Q, L228H  
>9125-30918| codons 38-247
CTELEKDGKISKIGPENPYNTPIFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
GGIKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKVAELRNYLWKWGFYTP
DNKHQQEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006