<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9133 9133-30918 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54M, V82A, L90M L33F, K43KT, Q58QE L10I, R41K, D60E, I62V, L63P, A71V  
>9133-30918| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVFEEMNLPGKWTPKLIGGIGGFMKVREYEQVP
IEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215CDGY K219R Y181C, G190A V108I K101Q, V111I, V118I, D121H, K122E, I135T, K166KR, V189VI, H208Y, R211K, H221Y  
>9133-30918| codons 38-246
CTELEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTILDIGDAYFSIPLHEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPDIVICQYVDDLYIASDLEIGQHRTKIEELRQYLWKWGFYTP
DRKYQKEPPFLWMGYELHPDKWTVQPIVL

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006