<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9143 9143-30929 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10FI, G73S T12P, K14R, K20KT, E34Q, P39Q, R41K, L63P, I66V, A71T, I72R, V77I, P79D, T91S, I93L, C95F  
>9143-30929| codons 4-99
TLWQRPIVPIRIGGQLTEALLDTGADDTVLQEMNLQGKWKPKIIGGIGGFVKVRQYDQIP
IEVCGHKTRSTVLIGDTPVNVIGRNLMSQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, Q151M, L210W, T215Y   G190GRS   E44D, K64R, K101KQ, V111I, V118I, D123E, I135T, E169D, K173E, V179I, Q207E, H208Y, R211K  
>9143-30929| codons 38-244
CTELEKDGKISKIGPENPYNTPVFAIRKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDIGDAYFSIPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILDPFREQNPDIIIYQYMDDLYVSSDLEIGQHRTKIEELREYLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPI

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006