<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9150 9150-30908 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54A, V82T, L90M   L10I, T12TS, L19I, K20M, M36MIV, I62V, L63P, I64V, A71V, I72V, I93L  
>9150-30908| codons 4-99
TLWQRPIVSIKIGGQIMEALLDTGADDTVLEEVNLPGRWKPKMIVGIGGFAKVRQYDQVP
VEICGHKVVGTVLVGPTPTNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q     K49R, K101KI, K122E, D123N, I135T, T139M, D177E, V179I, I202V, R211K, L228LH E53EK
>9150-30908| codons 38-247
CTEMEKEGKISRIGPKNPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLIKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSTNNEMPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIIIYQYVDDLYVGSDLEIGQHRTKVEELRQHLLKWGFFTP
DQKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006