<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9122 9122-30930 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L33F, K43KT, F53L, G73S L10I, I13V, I15V, K20R, L24F, E35D, M36I, K55R, I62V, L63P, A71V, I72V  
>9122-30930| codons 4-99
TLWQRPIVTVKVGGQLREALFDTGADDTVFEDINLPGRWTPKMIGGIGGLVRVRQYDQVP
IEICGHKVVSTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y K219N Y181C   T39A, K43Q, K49R, V118I, K122E, I135T, V179I, V245E  
>9122-30930| codons 38-247
CAELEQEGKISRIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIICQYVDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006