<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9123 9123-30930 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M G73T L10I, K20I, N37E, I62V, L63P, C67F, K70R, V77VI  
>9123-30930| codons 4-99
TLWQRPIVTIKIGGQLIEALLDTGADDTVLEEMELPGRWKPKIIGGIGGFVKVRQYDQVP
IEIFGHRAITTVLIGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219E K103N   V60I, T69N, K122E, I135T, S162A, Q174H, V179I, V245E L228Y
>9123-30930| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRKHNPDIIIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFFTP
DEKHQKEPPFYWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006