<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9115 9115-30924 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82A, I84V L33F, Q58E, T74P L10V, I13V, K20R, M36I, N37D, R41RK, I62V, L63T, I64V, E65D  
>9115-30924| codons 4-99
TLWQRPVVTVKIGGQLREALLDTGADDTVFEEIDLPGKWKPKIIGGIGGFIKVREYDQVT
VDICGHKAIGPVLVGPTPANVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215Y   Y188L   S68G, D121H, K122E, I135T, S162C, R172K, D177E, I178L, T200TA, E224D  
>9115-30924| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLHEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFKKQNPELVIYQYMDDLLVGSDLEIGQHRAKIEELRQHLLRWGFYTP
DKKHQKDPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006