<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9117 9117-30923 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47IV, I54V, V82VA, L90M L33LFI, N88G L10I, I13V, Q18H, K20KT, M36MI, N37ND, L63P, A71IL, V77I, L89LIM, I93L  
>9117-30923| codons 4-99
TLWQRPIVTVKIGGHLTEALLDTGADDTVIEEIDLPGRWKPKIVGGIGGFVKVRQYDQIP
IEICGHKLIGTVLIGPTPANIIGRGMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215Y V75M, K219Q K101KPQT, K103KN   V60I, K122E, D123DN, I135T, I142V, I178L, E203K, Q207E  
>9117-30923| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLTKNKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDLVIYQYMDDLYVGSDLEIGQHRTKIKELREHLLRWGFYTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006