<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9112 9112-30918 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MIL, I54V, V82A, L90M G73S L10I, L19V, K55R, I62IV, L63P, C67F, H69Q, A71V, C95CFLR  
>9112-30918| codons 4-99
TLWQRPIVTIKIGGQVKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVRVRQYDQVP
IEIFGQKVISTVLVGPTPANIIGRNLMTQIGRTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184MV K219Q K103N   T39M, V60I, T69N, K104KQ, K122E, I135T, T200A, R211RK, V245E  
>9112-30918| codons 38-247
CMEMEKEGKISKIGPENPYNTPIFAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNQSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGFTTP
DQKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006