<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9113 9113-30918 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, V82C, L90M L10F, F53FL, G73T I62V, L63P, V77I, I93L  
>9113-30918| codons 4-99
TLWQRPFVTIKIGGQLKEALLDTGADDTILEEMNLPGRWKPKIVGGIGGLIKVRQYDQVP
IEICGHKAITTVLIGPTPCNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184MV, T215F K219Q K103S, G190A   T39A, I94L, K122E, D123S, V179I, T200A, E203K, Q207E, K223Q, V245VM  
>9113-30918| codons 38-247
CAEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGLPHP
AGLKKSKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIIYQYVDDLYVASDLEIGQHRAKIKELREHLLRWGFFTP
DQKHQQEPPFLWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006