<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9111 9111-30918 Brazil 2003 HIV1 U Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70KR, M184V, T215F V75I, K219Q L100I, K103N   T39A, E40D, V118I, E169D, T200A, R211T, F214L, L228H, V245E K223KI
>9111-30918| codons 38-247
CADLEKEGKISKIGPENPYNTPVFAIKKKNSDRWRKLIDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILDPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLLTWGLFTP
DQKHQIEPPFHWMGYELHPDKWTVQPIELP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A V11I, L24I, G73S L10I, A22V, E35D, M36I, N37D, R41K, K55KR, R57K, D60E, Q61D, I62V, L63P, A71V, I72T  
>9111-30918| codons 4-99
TLWQRPIITIKIGGQLKEVLIDTGADDTVLEDIDLPGKWKPKLIGGIGGFVRVKQYEDVP
IEICGHKVTSTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006