<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9106 9106-30915 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L10FI, L24I, L33F I15V, L19I, K43I, K55R, R57K, I62V, L63P, A71V  
>9106-30915| codons 4-99
TLWQRPIVTIKVGGQIKEALIDTGADDTVFEEMNLPGRWIPKLIGGIGGFVRVKQYDQVP
IEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, M184MV, L210W, T215Y F77L, K219N K101KE, G190E A98AG, E138K T39A, E44ED, W88WS, I94IL, V118I, K122E, S162Y, V189VI, R211K, V245E  
>9106-30915| codons 38-247
CAELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKLMDLRELNKRTQDFSEVQLGLPHP
GGLEKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNKTPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPDIVIYQYVDDLYIESDLEIGQHRTKIEELRQHLWKWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006