<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9103 9103-30908 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54S, V82A L33F L10I, I13V, E35D, M36MIL, N37D, I62V, I64V, T74A, I93L  
>9103-30908| codons 4-99
TLWQRPIVTVKIGGQLKEALLDTGADDTVFEDLDLPGRWKPKMIVGIGGFSKVRQYDQVL
VEICGHKAIGAVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219KE Y188YFHL   E44D, K64R, V118I, K122E, T200I, E203EK, Q207AE, R211K, K223KT F124FV
>9103-30908| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIRKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDVRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLLVGSDLEIGQHRIKIKELREHLWKWGFYTP
DEKHQTEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006