<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9380 9380-30930 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L33F, G73S L10I, I13IV, K14KR, I15V, L19V, K20KT, E35D, M36L, N37D, R57RK, I62V, L63P, A71V, I72L, I85IV  
>9380-30930| codons 4-99
TLWQRPIVTVRVGGQVTEALLDTGADDTVFEDLDLPGRWKPKMIGGIGGFVKVKQYDQVP
IEICGHKVLSTVLVGPTPANIVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, T215F K219Q L100I, K103N   V118I, K122E, I135T, T139K, G196E, E203D, R211K, F214L, L228LH, V245Q H235HR
>9380-30930| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNEKPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIEQHRTKIDELRQHLLKWGLFTP
DQKHQKEPPFHWMGYELRPDKWTVQPIQLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006