<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9379 9379-30930 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74LI, T215F K219Q G190A   T39K, K43E, K101I, D123E, S162SDGN, K166R, D177E, V179I, G196E, L228LH  
>9379-30930| codons 38-247
CKEMEEEGKISKIGPENPYNTPVFAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLIKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQNSMTRILEPFRKQNPEIIIYQYMDDLYVASDLEIEQHRTKIEELRQHLLRWGFFTP
DQKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, I84V, L90M V11I, G73S L10I, K20I, E34Q, M36I, K55R, R57RK, I62V, L63P, H69R, A71V  
>9379-30930| codons 4-99
TLWQRPIITIKIGGQLIEALLDTGADDTVLQEINLPGRWKPKIIGGIGGFVRVKQYDQVP
IEICGRKVISTVVVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006