<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9154 9154-30930 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47V, I54L, I84V, L90M L33F, G73T L10I, E35ED, M36L, Q61N, L63P, I64V, I66F  
>9154-30930| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTIFEDLNLPGRWKPKMVGGIGGFLKVRQYDNIP
VEFCGHKAITTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q K101E, Y181I, G190A V179D A98S, K104Q, V118I, K122E, D123DGNS, I135T, E138EG, R211K, F214L, D218E, L228H, D237N  
>9154-30930| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLEKKQSVTVLDVGDAYFSIPLDESFRKYTAFTIPSTNNGTPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIDIIQYVDDLYVASDLEIGQHRTKIEELRQHLLKWGLFTP
EQKHQKEPPFHWMGYELHPNKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006