<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9375 9375-30929 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V V75T L100I, K103N   D123E, I135T, V179VI, I202V, E203EQ, R211K, F214L, V245Q  
>9375-30929| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVTDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIIYQYMDDLYVGSDLEIGQHRTKVQELRQHLLKWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10V, I13V, Q18L, E35D, M36I, R41K, R57K, Q61N, I62V, T74S, V77I, L89M  
>9375-30929| codons 4-99
TLWQRPVVTVKIGGLLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDNVL
IEICGHKAIGSVLIGPTPVNIIGRNMMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006