<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9164 9164-30925 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54L, V82A, I84V, L90M L33F, Q58E L10I, I13IV, K20R, E35D, M36I, N37E, K55R, I62V, L63P, C67F, H69K, A71V, I72T, Q92K, I93V  
>9164-30925| codons 4-99
TLWQRPIVTVKIGGQLREALLDTGADDTVFEDIELPGRWKPKLIGGIGGFLRVREYDQVP
IEIFGKKVTGTVLVGPTPANVIGRNLMTKVGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y   L100I, K103N   D123E, I142V, Q174L, I202V, Q207A, L228HR  
>9164-30925| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKLNPDIVIYQYVDDLYVGSDLEIGQHRTKVEELRAHLLRWGFYTP
DKKHQKEPPFRWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006