<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9165 9165-30925 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R V75S, T215I, K219E K101E, Y181C, G190A   K122E, K173N, Q174K, G196GE, T200V, R211K, L228H, V245T  
>9165-30925| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSDRWRKLSDFRELNKRTQDFWEVQLGIPHP
AGLEKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRNKNPDIVICQYMDDLYVASDLEIEQHRVKIEELRQHLLKWGFITP
DEKHQKEPPFHWMGYELHPDKWTVQPITLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, M36I, N37S, R41K, I64V, I72V  
>9165-30925| codons 4-99
TLWQRPLVTIKVGGQLKEALLDTGADDTVLEEISLPGKWKPKMIGGIGGFIKVRQYDQIL
VEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006