<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9166 9166-30925 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70R, Q151M V75I, F77L, F116Y Y188YH   S48T, S68G, K122E, D123S, Q174H, D177E, V179I, T200A, I202IV, R211S, F214L  
>9166-30925| codons 38-247
CTEMEKEGKITKIGPENPYNTPVFAIKRKDGTRWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYYSVPLDESFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRKHNPEIIIYQYMDDLHVGSDLEIGQHRAKVEELRQHLLSWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, L90LM L10F, L33I, N88D E35D, M36I, R41K, I62IMV, L63P, L89F, I93L  
>9166-30925| codons 4-99
TLWQRPFVTIKIGGQLKEALLDTGADNTVIEDINLPGKWKPKMIGGIGGFIKVRQYDQVP
IEICGHKAIGTVLVGPTPVNIIGRDFMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006