<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9011 9011-30924 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69DY, K70R D67G, K219E K103N, G190A K101N S68G, K102KN, D121H, K122E, I135T, D177E  
>9011-30924| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKGGYRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLNNNKSVTVLDVGDAYFSVPLHEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVIYQYMDDLYVASDLEIGQHRTKIEELRQHLLRWGFTTP
DEKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M   L10I, T12P, Q18R, L19Q, K20M, L63P, A71T, V77I, I93L, C95CF  
>9011-30924| codons 4-99
TLWQRPIVPIKIGGRQMEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFVKVRQYDQIP
IEICGHKTIGTVLIGPTPANIIGRNLMTQLGFTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006