<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9160 9160-30924 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215F   L100I, K103N   T69TN, D121Y, K122E, D123E, I135T, I142V, S162A, I167IV, D177N, T200A, L228R, V245R  
>9160-30924| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDSNKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSVPLYEEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQASMTKVLEPFRKQNPNIVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLWRWGFFTP
DKKHQKEPPFRWMGYELHPDKWTVQPIRLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, L90M L10F, Q58E, G73GS I13V, K20I, M36I, N37S, I62V, L63P, A71T, I72IT, I93L  
>9160-30924| codons 4-99
TLWQRPFVTVKIGGQLIEALLDTGADDTVLEEISLPGRWKPKIVGGIGGFVKVREYDQVP
IEICGHKTTSTVLVGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006