<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9006 9006-30923 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54A, V82A L24I, Q58E, L89V L10Y, I13IMV, I15V, K20I, E34KQ, E35D, M36I, N37NS, R41K, R57K, D60E, I62IV, L63P, A71V, I93L  
>9006-30923| codons 4-99
TLWQRPYVTVKVGGQLIEALIDTGADDTVLQDISLPGKWKPKMIGGIGGFAKVKEYEQVP
IEICGHKVIGTVLVGPTPANIIGRNVLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215Y K219E Y181C A98G, K101HQ K122E, D123S, I135T, D177E, Q197L, T200A, E203EA, Q207E, V245T V60VIM
>9006-30923| codons 38-247
CTEMEKEGKISKIGPENPYNTPMFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLQKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVICQYVDDLYVGSDLEIGLHRAKIAELREHLLRWGFYTP
DEKHQKEPPFLWMGYELHPDKWTVQPITLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006