<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9008 9008-30923 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74V, T215F K219Q Y181C, G190A K101H T39A, V60I, K103R, K122P, I135T, A158S, D177E, R211K, D218E, L228H, V245L H235HR
>9008-30923| codons 38-247
CAELEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLHKRKSVTVLDVGDAYFSVPLDPDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
SIFQSSMTKILEPFRKQNPEIVICQYMDDLYVASDLEIGQHRTKIEELRQHLLKWGFFTP
EQKHQKEPPFHWMGYELRPDKWTVQPILLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L10F, L24I, L33F, G73T L19I, K20R, E35D, M36I, R41K, L63P, A71V, I72IM  
>9008-30923| codons 4-99
TLWQRPFVTIKIGGQIREALIDTGADDTVFEDINLPGKWKPKMIGGIGGFVKVRQYDQIP
IEICGHKVMTTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006