<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9007 9007-30923 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   Y188L V179D V106I, K122E, D123E, I167V, K173T, T200A, R211K, E224D D237A
>9007-30923| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSITVLDVGDAYFSVPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKVLEPFRTQNPDIDIYQYMDDLLVGSDLEIGQHRAKIEELRQHLWKWGFYTP
DKKHQKDPPFLWMGYELHPAKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I50V, V82M L24I, L33F L10I, T12P, K14R, E35ED, M36ML, K55R, L63P, C67DE, H69K, A71V, V77I  
>9007-30923| codons 4-99
TLWQRPIVPIRIGGQLKEALIDTGADDTVFEDLNLPGRWKPKLIGGVGGFIRVRQYDQIP
IEIEGKKVIGTVLIGPTPMNIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006