<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9098 9098-30930 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, T215F D67H, K219E Y181C   T69N, A98S, K122KE, S162SN, K166KR, H208HY, R211K, D218E, L228H K43HQ
>9098-30930| codons 38-247
CTEMEQEGKISKIGPENPYNTPVFAIKKKHSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQNSMTRILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQYLLKWGFFTP
EEKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L10F, F53FL K20R, E35D, M36V, N37E, K55KR, R57K, D60E, I62V, L63P, A71V, V77I, I93L  
>9098-30930| codons 4-99
TLWQRPFVTIKIGGQLREALLDTGADDTVLEDVELPGRWKPKMIGGIGGLVRVKQYEQVP
IEICGHKVIGTVLIGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006