<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9097 9097-30930 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I50V, I54T, V82A G73GA, L89V L10I, I15V, K20R, E35D, M36I, R41K, I62V, L63P, G68GE, A71V, I72V, I85V  
>9097-30930| codons 4-99
TLWQRPIVTIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIVGVGGFTKVRQYDQVP
IEICEHKVVATVLVGPTPANIVGRNVLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, T215F K219Q K103N   K43Q, T69N, A98AS, D121H, K122E, I135T, S162C, K173Q, I178IL, T200A, D218E, L228H, V245E  
>9097-30930| codons 38-247
CTELEQEGKISKIGPENPYNTPVFAIKKKNSNRWRKIVDFRELNKRTQDFWEVQLGIPHP
SGLKKNKSVTVLDVGDAYFSVPLHEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRQQNPDLVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFFTP
EQKHQKEPPFHWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006