<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9093 9093-30827 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L76LV, V82A   L10I, I15V, G16E, K20KT, R41K, L63H, A71T  
>9093-30827| codons 4-99
TLWQRPIVTIKVEGQLTEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFVKVRQYDQIH
IEICGHKTIGTVVVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151QKLM, M184V F116Y K103DN   E42G, K102R, K122E, I135IT, I178M, I202V T84TP, V111M
>9093-30827| codons 38-247
CTEMGKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRPQDFWEVQLGIPHP
AGLKRNKSVTVLDMGDAYYSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRKQNPDMVIYQYVDDLYVGSDLEIGQHRTKVEELRQHLLRWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006