<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9088 9088-30827 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A L33F, K43KT, F53L, N83D L10I, I13V, L19I, K20R, E35D, M36I, N37C, R57K, I62V, L63Q, I64V, C67Y, I72V, V75I, T91TA  
>9088-30827| codons 4-99
TLWQRPIVTVKIGGQIREALLDTGADDTVFEDICLPGRWTPKMIVGIGGLVKVKQYDQVQ
VEIYGHKAVGTILVGPTPADIIGRNLLAQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W, T215Y D67G, K70T, K219N   V108VI E40F, K43E, S68G, V118I, K122P, Q174QR, D177E, I178F, E203K, Q207D, H208Y, R211K, K223Q, L228H  
>9088-30827| codons 38-247
CTFLEEEGKISKIGPENPYNTPVFAIKKKGGTTWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTILDVGDAYFSIPLDPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKRNPEFVIYQYMDDLYVGSDLEIGQHRTKIKELRDYLWKWGFYTP
DNKHQQEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006