<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9085 9085-30827 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82VA, L90M L33F, G73GS L10I, T12K, I13V, L19I, Q61QH, L63P, E65ED, H69Q, A71AV, V77I, I93M  
>9085-30827| codons 5-99
LWQRPIVKVKIGGQIKEALLDTGADDTVFEEMNLPGRWKPKIIGGIGGFVKVRQYDHIPI
DICGQKVISTVLIGPTPANIIGRNLMTQMGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LV, L210LW, T215Y   V106VA, Y181YC, G190GA V108VI T39A, E44D, K102KQ, K122P, I135T, S162SC, F171FY, D177E, G196E, T200TA, E203EK, Q207E, K223KE, L228LH  
>9085-30827| codons 38-247
CAELEKDGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKQKKSATILDVGDAYFSVPLDPDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPYRKQNPEIVICQYMDDLYVASDLEIEQHRAKIKELREHLWRWGFYTP
DKKHQEEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006