<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9089 9089-30827 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82F, I84V, L90M L33F, K43T, T74P L10I, I13V, L19I, M36L, N37ND, I62V, I64V, I72V, I93L  
>9089-30827| codons 4-99
TLWQRPIVTVKIGGQIKEALLDTGADDTVFEELDLPGRWTPKIIGGIGGFIKVRQYDQVL
VEICGHKAVGPVLVGPTPFNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y       V60I, V118I, K122E, I135T, T139M, S162C, E203ED, H208Y, R211RK  
>9089-30827| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNEMPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIDELRQYLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006