<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9326 9326-30929 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y   K101E, G190S A98G V60VI, S68G, K122E, D123N, I135T, E138A, V189VI, T200A, E204D, Q207A, V245T  
>9326-30929| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLEKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYISSDLEIGQHRAKIEDLRAHLLRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPITLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L10F, L24I I15V, E35D, N37T, R57K, D60E, I62V, L63P, I64V, A71V, I72IV, I93L  
>9326-30929| codons 4-99
TLWQRPFVTIKVGGQLKEALIDTGADDTVLEDMTLPGRWKPKIIGGIGGFVKVKQYEQVP
VEICGHKVVGTVLVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006