<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9321 9321-30924 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q Y188L   V60VI, K122E, T139TA, S162Y, Q174K, N175Y, Q207E, R211K  
>9321-30924| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNEAPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKKYPDIVIYQYMDDLLVGSDLEIGQHRTKIEELREHLLKWGFFTP
DQKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, V82A, L90M L33LF, G73T L10I, N37D, I62V, L63P, A71I, V77I, I93L  
>9321-30924| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVFEEMDLPGRWKPKIIGGIGGFVKVRQYDQVP
IEICGHKIITTVLIGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006