<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9314 9314-30922 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184MV K219Q K101KE, K103KN, V106IM, Y181I, M230ML   K43R, V118I, K122E, D123N, I135T, E138EA, Q174R, V179VG, T200A, I202V, F214L, H221Y, K238R, V245T Y232H
>9314-30922| codons 38-247
CTEMEREGKISKIGPENPYNTPVFAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLEKNKSMTVLDVGDAYFSIPLDENFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKRNPDIGIIQYVDDLYVGSDLEIGQHRAKVEELRQHLLRWGLTTP
DQKYQKEPPFLWLGHELHPDRWTVQPITLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M L23I, Q58E L10V, L19I, E35D, M36I, N37S, R41K, I62V, L63P, A71V, I72IV, I93L R8Q
>9314-30922| codons 4-99
TLWQQPVVTIKIGGQIKEAILDTGADDTVLEDISLPGKWKPKLIGGIGGFVKVREYDQVP
IEICGHKVVGTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006