<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9236 9236-30917 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L33F, K43T, F53L L10I, I13V, K14R, N37S, Q61H, L63P, A71V, C95F  
>9236-30917| codons 4-99
TLWQRPIVTVRIGGQLKEALLDTGADDTVFEEMSLPGRWTPKMIGGIGGLVKVRQYDHIP
IEICGHKVIGTVLVGPTPANIIGRNLMTQIGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       T39A, K43E, S68SG, K102Q, V118VI, K122E, I135IV, I178L, V179VI, R211RK, V245M  
>9236-30917| codons 38-247
CAELEEEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKQKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDLIIYQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006