<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9235 9235-30917 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47IV, I54IL, L76V, I84V, L90M L10FI, G73GAST I13IM, Q18QHR, K20I, E34EQ, E35D, N37DE, L63P, I64V, H69HR, K70R, A71AV, I72IL, I85IV, T91TS  
>9235-30917| codons 4-99
TLWQRPIVTMKIGGRLIEALLDTGADDTVLQDMELPGRWKPKIVGGIGGFLKVRQYDQIP
VEICGRRVLTTVVVGPTPVNVVGRNLMSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184I, L210W, T215Y K219R G190GA F227FL E44D, V118I, K122E, I142IV, E203K, Q207DE, H208HY, R211K, K223Q  
>9235-30917| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYIDDLYVASDLEIGQHRTKIKELREYLWKWGFYTP
DRKHQQEPPLLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006