<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-9232 9232-30916 Brazil 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73S L10V, I15V, K20T, N37D, L63P, A71V, V77I, I93L  
>9232-30916| codons 4-99
TLWQRPVVTIKVGGQLTEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFIKVRQYDQIP
IEICGHKVISTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V, T215F D67G, K219E Y181C, G190A   S68G, I135T, I142V, K166R, Q174R, V179I, R211K, D218E, L228H, V245E  
>9232-30916| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKGGTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKRNPDIIICQYVDDLYVASDLEIGQHRTKIEELRQHLLKWGFFTP
EEKHQKEPPFHWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006